Recombinant Proteins

Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.

Search Within Results

1,306 – 1,320 of 119,730 results

1,306

R&D Systems™ Recombinant Cynomolgus/Rhesus EpCAM/TROP1 His Protein

Measured by the ability of the immobilized protein to support the adhesion of the L Cells mouse fibroblast cell line.

Pricing & Availability

1,307

R&D Systems™ Recombinant Rat FGF-10 Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability
Specifications

Purity or Quality Grade	95%, by SDS-PAGE under reducing conditions and visualized by silver stain.
Conjugate	Unconjugated
Gene Alias	FGF10, FGF-10, fibroblast growth factor 10, Keratinocyte growth factor 2, KGF2, KGF-2, produced by fibroblasts of urinary bladder lamina propria
Molecular Weight (g/mol)	20.2 kDa
Gene ID (Entrez)	25443
Quantity	25 μg
Structural Form	Monomer
Storage Requirements	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70° C as supplied. 1 month, 2 to 8° C under sterile conditions after reconstitution. 3 months, -20 to -70° C under sterile conditions after reconstitution.
Source	E. coli-derived rat FGF-10 protein Gln37-Ser215,with an N-terminal Met
Recombinant	Recombinant
Name	FGF-10

1,308

Novus Biologicals™ Recombinant Human IFIT3 His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Purity or Quality Grade	>80%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie™ Blue stain
Conjugate	Unconjugated
Gene Alias	CIG-49, GARG-49, IFI60Retinoic acid-induced gene G protein, IFIT-3, IFIT-4, IFIT4IFI-60K, interferon-induced protein with tetratricopeptide repeats 3, Interferon-induced protein with tetratricopeptide repeats 4Interferon-induced 60 kDa protein, IRG2, ISG60, ISG-60, RIG-GCIG49
Common Name	IFIT3
Molecular Weight (g/mol)	TMW: 58.4kDa
Gene ID (Entrez)	3437
Formulation	Phosphate buffered saline (pH7.4) containing 20% glycerol, 1mM DTT
Storage Requirements	Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles.
Concentration	1mg/mL
For Use With (Application)	SDS-PAGE
Recombinant	Recombinant

1,309

Novus Biologicals™ DCK Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Regulatory Status	RUO
Purification Method	Protein
Purity or Quality Grade	>90%
Conjugate	Unconjugated
Common Name	DCK
Molecular Weight (g/mol)	34.6kDa
Gene ID (Entrez)	1633
Immunogen	DCK, 1-260aa. Sequence: MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMATPPKRSCPSFSASSEGTRIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTQDEFEELTMSQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
Concentration	0.5mg/mL
For Use With (Application)	ELISA,SDS-PAGE
Source	Human

1,310

Novus Biologicals™ NTH1 Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

1,311

Novus Biologicals™ Recombinant Human COPS7A His Protein

Highly purified. Generating reliable and reproducible results. Applications: SDS-Page

Pricing & Availability
Specifications

Purity or Quality Grade	>80%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie™ Blue stain
Conjugate	Unconjugated
Gene Alias	COP9 (constitutive photomorphogenic, Arabidopsis, homolog) subunit 7A, COP9 complex subunit 7a, COP9 constitutive photomorphogenic homolog subunit 7A (Arabidopsis), COP9 signalosome complex subunit 7a, CSN7AMGC110877, Dermal papilla-derived protein 10, DERP10, JAB1-containing signalosome subunit 7a, SGN7a, Signalosome subunit 7a
Common Name	COPS7A
Molecular Weight (g/mol)	TMW: 32.7kDa
Gene ID (Entrez)	50813
Formulation	20mM Tris-HCl buffer (pH 8.0) containing 0.4M UREA, 10% glycerol
Storage Requirements	Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles.
Concentration	0.5mg/mL
For Use With (Application)	SDS-PAGE
Recombinant	Recombinant

1,312

Novus Biologicals™ Recombinant Plant Betula verrucosa 7.0101 Strep (N-Term) Protein

Recombinant Protein

Pricing & Availability

1,313

Novus Biologicals™ TCEB2 Recombinant Protein Antigen

Recombinant Protein

Pricing & Availability

1,314

Novus Biologicals™ CLTB Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Regulatory Status	RUO
Purification Method	SDS-PAGE
Purity or Quality Grade	>85%
Conjugate	Unconjugated
Common Name	CLTB
Storage Requirements	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
For Use With (Application)	SDS-PAGE
Source	Human

1,315

Novus Biologicals™ HSPB3 Protein

Highly purified. Generating reliable and reproducible results. Applications: SDS-Page

Pricing & Availability
Specifications

Regulatory Status	RUO
Purification Method	SDS-PAGE
Purity or Quality Grade	>85%
Conjugate	Unconjugated
Common Name	HSPB3
Storage Requirements	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
For Use With (Application)	SDS-PAGE
Source	Human

1,316

Novus Biologicals™ NANP Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Regulatory Status	RUO
Purification Method	Protein
Purity or Quality Grade	>90%
Conjugate	Unconjugated
Common Name	NANP
Molecular Weight (g/mol)	31.9kDa
Gene ID (Entrez)	140838
Formulation	Liquid. 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol, 2mM DTT, 100mM NaCl
Immunogen	NANP, 1-248aa. Sequence: MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMGLSRVRAVFFDLDNTLIDTAGASRRGMLEVIKLLQSKYHYKEEAEIICDKVQVKLSKECFHPYNTCITDLRTSHWEEAIQETKGGAANRKLAEECYFLWKSTRLQHMTLAEDVKAMLTELRKEVRLLLLTNGDRQTQREKIEACACQSYFDAVVVGGEQREEKPAPSIFYYCCNLLGVQPGDCVMVGDTLETDIQGGLNAGLKATVWINKNGIVPLKSSPVPHYMVSSVLELPALLQSIDCKVSMST
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
Concentration	0.5mg/mL
For Use With (Application)	ELISA,SDS-PAGE
Source	Human

1,317

Novus Biologicals™ Recombinant Human Glucose 6 phosphate isomerase His Protein

Recombinant Protein

Pricing & Availability

1,318

Novus Biologicals™ Recombinant Human NGFR/TNFRSF16/p75NTR His Protein

Highly purified. Generating reliable and reproducible results. Applications: SDS-Page

Pricing & Availability
Specifications

Purity or Quality Grade	>95%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie™ Blue stain
Conjugate	Unconjugated
Gene Alias	CD271, CD271 antigen, Gp80-LNGFR, member 16, nerve growth factor receptor, NGF receptor, p75 ICD, TNFRSF16nerve growth factor receptor (TNFR superfamily, member 16), tumor necrosis factor receptor superfamily member 16
Common Name	NGF R/TNFRSF16/p75NTR
Molecular Weight (g/mol)	TMW: 24.6kDa
Gene ID (Entrez)	4804
Formulation	Phosphate buffered saline (pH 7.4) containing 10% glycerol
Storage Requirements	Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles.
Concentration	1mg/mL
For Use With (Application)	SDS-PAGE
Source	Baculovirus
Recombinant	Recombinant

1,319

Novus Biologicals™ PMP70 Recombinant Protein Antigen

Recombinant Protein

Pricing & Availability

1,320

Novus Biologicals™ Proteasome 20S alpha 6 Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

Prev
1
...
86
87
88
89
...
7,982
Next

Recombinant Proteins

Filtered Search Results

Narrow Results

Novus Biologicals™ Recombinant Human IFIT3 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ DCK Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ NTH1 Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human COPS7A His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Plant Betula verrucosa 7.0101 Strep (N-Term) Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ TCEB2 Recombinant Protein Antigen Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ CLTB Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ HSPB3 Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ NANP Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human Glucose 6 phosphate isomerase His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human NGFR/TNFRSF16/p75NTR His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ PMP70 Recombinant Protein Antigen Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Proteasome 20S alpha 6 Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human IFIT3 His Protein

Novus Biologicals™ DCK Protein

Novus Biologicals™ NTH1 Protein

Novus Biologicals™ Recombinant Human COPS7A His Protein

Novus Biologicals™ Recombinant Plant Betula verrucosa 7.0101 Strep (N-Term) Protein

Novus Biologicals™ TCEB2 Recombinant Protein Antigen

Novus Biologicals™ CLTB Protein

Novus Biologicals™ HSPB3 Protein

Novus Biologicals™ NANP Protein

Novus Biologicals™ Recombinant Human Glucose 6 phosphate isomerase His Protein

Novus Biologicals™ Recombinant Human NGFR/TNFRSF16/p75NTR His Protein

Novus Biologicals™ PMP70 Recombinant Protein Antigen

Novus Biologicals™ Proteasome 20S alpha 6 Protein